PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010521758.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family GATA
Protein Properties Length: 305aa    MW: 33312.4 Da    PI: 9.2903
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010521758.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.11.6e-20223257135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  XP_010521758.1 223 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 257
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.308217253IPR000679Zinc finger, GATA-type
SMARTSM004019.0E-19217267IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.9E-15219280No hitNo description
Gene3DG3DSA:3.30.50.103.4E-15221254IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.76E-17222271No hitNo description
PfamPF003202.6E-18223257IPR000679Zinc finger, GATA-type
PROSITE patternPS003440223248IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MNNGPWLPEV DFQGLSDDFF DDLMNHTDFP LEDVESGNGE GDWDAGFQGL EPPPMDMFSS  60
LSSGFNCGGN GISKGDHKPI PILKQCSSSE ASSDINSSAH GLSCPDVKVS KLFQSSSPVS  120
VLENSSNGSF SSSQSSRLKG LTAFPVKGMR SKRKRPTALK LKLLLPFELA KSQQFTAEAE  180
SESEIYYPSE KPAKKKRKKH KKIIHPTHPG SSSHSESGTT RKCTHCETTK TPQWREGPNG  240
PKTLCNACGV RFRSGRLVPE YRPAASPTFI PSVHSNSHRK IVEMRRKGGS QELNSGMIQT  300
VISRA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193201KKKRKKHKK
2194198KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010521758.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010521759.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-113GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A078E6Y11e-116A0A078E6Y1_BRANA; BnaC05g05680D protein
STRINGBra018665.1-P1e-112(Brassica rapa)
STRINGscaffold_401176.11e-112(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-83GATA transcription factor 11